Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692)

This Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69-2 IGHV1-69-2

UniProt

A0A0G2JMI3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGATVKISCKVSGYTFTDYYMHWVQQAPGKGLEWMGLVDPEDGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), 0.2mg/mL
BNUB2600-100 1x 100 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), 0.2mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Spleen
CS641506 5x 5 µm

Frozen Tissue Sections, Spleen

Sign In for Pricing
View Details
CTiVd TaqMan Probe/Primer and Control Set
TM50510 100 Reactions

CTiVd TaqMan Probe/Primer and Control Set

Sign In for Pricing
View Details
Involucrin (SY5), 0.2mg/mL
BNUB0678-500 1x 500 µL

Involucrin (SY5), 0.2mg/mL

Sign In for Pricing
View Details
ERK2 (MAPK1) Rabbit Polyclonal Antibody
TA378294 100 µL

ERK2 (MAPK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 4-Phenylacetoacetate
TRC-E925845-25G 25 g

Ethyl 4-Phenylacetoacetate

Sign In for Pricing
View Details