Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692)

This Recombinant Human Immunoglobulin heavy variable 1-69-2 (HV692) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-69-2 IGHV1-69-2

UniProt

A0A0G2JMI3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVQSGAEVKKPGATVKISCKVSGYTFTDYYMHWVQQAPGKGLEWMGLVDPEDGETIYAEKFQGRVTITADTSTDTAYMELSSLRSEDTAVYYCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fixed Volume Single Channel Micropipette BPIP-535
BPIP-535 1 Unit

Fixed Volume Single Channel Micropipette BPIP-535

Sign In for Pricing
View Details
PAF Receptor (PTAFR) (NM_001164723) Human Over-expression Lysate
LY431860 100 µg

PAF Receptor (PTAFR) (NM_001164723) Human Over-expression Lysate

Sign In for Pricing
View Details
ASB18 Human Gene Knockout Kit (CRISPR)
KN425789 1 Kit

ASB18 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Factor XIII (F13B) Mouse Monoclonal Antibody [Clone ID: OTI2H10]
CF805993 100 µg

Factor XIII (F13B) Mouse Monoclonal Antibody [Clone ID: OTI2H10]

Sign In for Pricing
View Details
Mouse Gabrb2 activation kit by CRISPRa
GA201519 1 Kit

Mouse Gabrb2 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ZNF513 activation kit by CRISPRa
GA115117 1 Kit

Human ZNF513 activation kit by CRISPRa

Sign In for Pricing
View Details