Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741)

This Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 7-4-1 IGHV7-4-1

UniProt

A0A0J9YVY3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTP1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-60581R-BF680 100 µL

GSTP1 Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
CADM2 AAV Vector (Human) (CMV)
14910101 1 µg

CADM2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Haematoxylin Solution Modified Acc. to Gill III for General Purpose Nuclear Stain Microscopy, co Progressive Type, Used with Hemtoxylin & Eosin Stains
844120 500 mL

Haematoxylin Solution Modified Acc. to Gill III for General Purpose Nuclear Stain Microscopy, co Progressive Type, Used with Hemtoxylin & Eosin Stains

Sign In for Pricing
View Details
Mouse Monoclonal CXCL10/IP-10/CRG-2 Antibody (6D4) [Alexa Fluor 405]
NBP2-59749AF405 0.1 mL

Mouse Monoclonal CXCL10/IP-10/CRG-2 Antibody (6D4) [Alexa Fluor 405]

Sign In for Pricing
View Details
Lentiviral human IL18RAP shRNA (UAS) - Lentiviral human IL18RAP shRNA (UAS, iRFP) (25)
GTR15133622 1 Vial

Lentiviral human IL18RAP shRNA (UAS) - Lentiviral human IL18RAP shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Bovine Phosphatidylinositol 3-kinase catalytic subunit type 3 (PIK3C3) ELISA Kit
GTR10339537 96 Well

Bovine Phosphatidylinositol 3-kinase catalytic subunit type 3 (PIK3C3) ELISA Kit

Sign In for Pricing
View Details