Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741)

This Recombinant Human Immunoglobulin heavy variable 7-4-1 (HV741) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 7-4-1 IGHV7-4-1

UniProt

A0A0J9YVY3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLQICSLKAEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenovirus (APC) discontinued
137525-APC 100 µL

Adenovirus (APC) discontinued

Sign In for Pricing
View Details
Human PAM qPCR Primer Pair
QH19593S 200 Tests

Human PAM qPCR Primer Pair

Sign In for Pricing
View Details
CAPZA2 Rabbit Polyclonal Antibody
TA349742 100 µL

CAPZA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GLUR2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-1798R-APC-Cy5.5 100 µL

GLUR2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
OmpA Polyclonal Antibody, FITC Conjugated
A55521-100 100 µL

OmpA Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
pLV2-CAG-Trp63-EGFP-Puro Plasmid
PVT49415 2 µg

pLV2-CAG-Trp63-EGFP-Puro Plasmid

Sign In for Pricing
View Details