Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D)

This Recombinant Human Immunoglobulin heavy variable 3-64D (HV64D) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-64D IGHV3-64D

UniProt

A0A0J9YX35

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCSASGFTFSSYAMHWVRQAPGKGLEYVSAISSNGGSTYYADSVKGRFTISRDNSKNTLYLQMSSLRAEDTAVYYCVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse SGCD shRNA Plasmid
abx973616-01 150 µg

Mouse SGCD shRNA Plasmid

Sign In for Pricing
View Details
Mouse SGCD shRNA Plasmid
abx973616-02 300 µg

Mouse SGCD shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral human OR5W2 shRNA (UAS) - Lentiviral human OR5W2 shRNA (UAS, GFP) (100)
GTR15353604 1 Vial

Lentiviral human OR5W2 shRNA (UAS) - Lentiviral human OR5W2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Porcine Stem Cell Factor (SCF) ELISA Kit
NSL0164Po 96 Tests

Porcine Stem Cell Factor (SCF) ELISA Kit

Sign In for Pricing
View Details
SCARF1 Human shRNA Lentiviral Particle (Locus ID 8578)
TL301821V 500 µL Each

SCARF1 Human shRNA Lentiviral Particle (Locus ID 8578)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa LPS-assembly protein lptD (lptD), partial
CSB-EP492739EZY-01 20 µg

Recombinant Pseudomonas aeruginosa LPS-assembly protein lptD (lptD), partial

Sign In for Pricing
View Details