Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 27 (TVB27)

This Recombinant Human T cell receptor beta variable 27 (TVB27) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 27 TRBV27

UniProt

A0A0K0K1C4

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTQNPRYLITVTGKKLTVTCSQNMNHEYMSWYRQDPGLGLRQIYYSMNVEVTDKGDVPEGYKVSRKEKRNFPLILESPSPNQTSLYFCASSL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-dsRNA monoclonal antibody J5 (200 μg)
JBS-RNT-SCI-10040200 200 µg

Anti-dsRNA monoclonal antibody J5 (200 μg)

Sign In for Pricing
View Details
anti-NSMase2
YF-PA19741 100 ug

anti-NSMase2

Sign In for Pricing
View Details
Mouse IL-17 RD/SEF Affinity Purified Polyclonal Ab
AF2276 100 µg

Mouse IL-17 RD/SEF Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
DDX42 Antibody
E310885 200 µL

DDX42 Antibody

Sign In for Pricing
View Details
Recombinant Human SYT7 Protein, N-His
orb2830488-01 20 µg

Recombinant Human SYT7 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SYT7 Protein, N-His
orb2830488-02 50 µg

Recombinant Human SYT7 Protein, N-His

Sign In for Pricing
View Details