Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EphA1 Protein Vector (Rat) (pPB-C-His)
PV266322 500 ng

EphA1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
RPL14 Protein Vector (Human) (pPM-C-HA)
PV035823 500 ng

RPL14 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
EIF4G3 Protein Vector (Mouse) (pPB-C-His)
PV175178 500 ng

EIF4G3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Slc30a2 (NM_001083122) Rat Untagged Clone
RN200431 10 µg

Slc30a2 (NM_001083122) Rat Untagged Clone

Sign In for Pricing
View Details
4- (5-Chlorothiophene-2-sulfonamido) benzoic acid
ENA90672-01 250 mg

4- (5-Chlorothiophene-2-sulfonamido) benzoic acid

Sign In for Pricing
View Details
4- (5-Chlorothiophene-2-sulfonamido) benzoic acid
ENA90672-02 2.5 g

4- (5-Chlorothiophene-2-sulfonamido) benzoic acid

Sign In for Pricing
View Details