Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-1 (TVB61)

This Recombinant Human T cell receptor beta variable 6-1 (TVB61) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-1 TRBV6-1

UniProt

A0A0K0K1D8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC16 (NM_032327) Human Over-expression Lysate
LC410203 20 µg

ZDHHC16 (NM_032327) Human Over-expression Lysate

Sign In for Pricing
View Details
Goat Red Blood Cells Packed 100% 15ml
IGTRBC100P15ML 15 mL

Goat Red Blood Cells Packed 100% 15ml

Sign In for Pricing
View Details
HMGN2P15 Protein Vector (Human) (pPB-N-His)
PV083842 500 ng

HMGN2P15 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
CBP (Acetyl Lys1535) rabbit pAb
ES1095-01 50 µL

CBP (Acetyl Lys1535) rabbit pAb

Sign In for Pricing
View Details
CBP (Acetyl Lys1535) rabbit pAb
ES1095-02 100 µL

CBP (Acetyl Lys1535) rabbit pAb

Sign In for Pricing
View Details
KCNN1 Human qPCR Primer Pair (NM_002248)
HP205978 200 Reactions

KCNN1 Human qPCR Primer Pair (NM_002248)

Sign In for Pricing
View Details