Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77)

This Recombinant Human T cell receptor beta variable 7-7 (TVB77) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inositol-Trisphosphate 3-Kinase A (ITPKA) Antibody
abx033924-01 80 µL

Inositol-Trisphosphate 3-Kinase A (ITPKA) Antibody

Sign In for Pricing
View Details
Inositol-Trisphosphate 3-Kinase A (ITPKA) Antibody
abx033924-02 400 µL

Inositol-Trisphosphate 3-Kinase A (ITPKA) Antibody

Sign In for Pricing
View Details
Phospho-MAX protein (Tyr123) Polyclonal Antibody, PE-Cy7 Conjugated
bs-5425R-PE-Cy7 100 µL

Phospho-MAX protein (Tyr123) Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
PARP3, CT (NAD+ ADP-ribosyltransferase 3 PARP-3, Putative Uncharacterized Protein, Adprtl3) (FITC)
MBS6492151-01 0.2 mL

PARP3, CT (NAD+ ADP-ribosyltransferase 3 PARP-3, Putative Uncharacterized Protein, Adprtl3) (FITC)

Sign In for Pricing
View Details
PARP3, CT (NAD+ ADP-ribosyltransferase 3 PARP-3, Putative Uncharacterized Protein, Adprtl3) (FITC)
MBS6492151-02 5x 0.2 mL

PARP3, CT (NAD+ ADP-ribosyltransferase 3 PARP-3, Putative Uncharacterized Protein, Adprtl3) (FITC)

Sign In for Pricing
View Details
TMEM44 (NM_001011655) Human Tagged ORF Clone Lentiviral Particle
RC202358L4V 200 µL

TMEM44 (NM_001011655) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details