Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-7 (TVB77)

This Recombinant Human T cell receptor beta variable 7-7 (TVB77) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-7 TRBV7-7

UniProt

A0A0K0K1E9

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVTLRCDPISSHATLYWYQQALGQGPEFLTYFNYEAQPDKSGLPSDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Olfr180 (NM_001011662) AAV Particle
MR217069A1V 250 µL

Mouse Olfr180 (NM_001011662) AAV Particle

Sign In for Pricing
View Details
MAFF (NM_001161574) Human Tagged ORF Clone
RC228733 10 µg

MAFF (NM_001161574) Human Tagged ORF Clone

Sign In for Pricing
View Details
SDMA
S5838-10mM/1mL 10 mM/1mL

SDMA

Sign In for Pricing
View Details
Lentiviral mouse Leng8 shRNA (UAS) - Lentiviral mouse Leng8 shRNA (UAS, GFP) plasmid
GTR15255946 1 Vial

Lentiviral mouse Leng8 shRNA (UAS) - Lentiviral mouse Leng8 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
GAPDHP34 Adenovirus (Human)
21268051 1.0 mL

GAPDHP34 Adenovirus (Human)

Sign In for Pricing
View Details
c-Raf Blocking Peptide
MBS9625411-01 1 mg

c-Raf Blocking Peptide

Sign In for Pricing
View Details