Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 10-2 (TVBJ2)

This Recombinant Human T cell receptor beta variable 10-2 (TVBJ2) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 10-2 TRBV10-2

UniProt

A0A0K0K1G8

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQSPRYKITETGRQVTLMCHQTWSHSYMFWYRQDLGHGLRLIYYSAAADITDKGEVPDGYVVSRSKTENFPLTLESATRSQTSVYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiLink™ Rapid Cy3 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*
1290-AAT 2 Labelings

ReadiLink™ Rapid Cy3 Antibody Labeling Kit *Microscale Optimized for Labeling 50 μg Antibody Per Reaction*

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (CPTC-ANXA1-1), CF594 conjugate, 0.1mg/mL
BNC942223-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (CPTC-ANXA1-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAPPC2B (NR_002166) Human Over-expression Lysate
LY403766 100 µg

TRAPPC2B (NR_002166) Human Over-expression Lysate

Sign In for Pricing
View Details
Hydrazine Acetate
TRC-H685000-25G 25 g

Hydrazine Acetate

Sign In for Pricing
View Details
Calpastatin (CAST) Human Gene Knockout Kit (CRISPR)
KN402168 1 Kit

Calpastatin (CAST) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WWOX (NM_001291997) Human Tagged ORF Clone
RG237308 10 µg

WWOX (NM_001291997) Human Tagged ORF Clone

Sign In for Pricing
View Details