Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76)

This Recombinant Human T cell receptor beta variable 7-6 (TVB76) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr342 CRISPR Activation Plasmid (m2)
sc-435039-ACT-2 20 µg

Olfr342 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Mouse Monoclonal S100A5 Antibody (S100A5/7475) [DyLight 488]
NBP3-24012G 0.1 mL

Mouse Monoclonal S100A5 Antibody (S100A5/7475) [DyLight 488]

Sign In for Pricing
View Details
Rat Atxn7l3 Pre-designed siRNA Set B
SI201211B 1 Each

Rat Atxn7l3 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Caldesmon (Ab-759) Antibody
orb127567-01 25 µg

Caldesmon (Ab-759) Antibody

Sign In for Pricing
View Details
Caldesmon (Ab-759) Antibody
orb127567-02 50 µg

Caldesmon (Ab-759) Antibody

Sign In for Pricing
View Details
Caldesmon (Ab-759) Antibody
orb127567-03 100 µg

Caldesmon (Ab-759) Antibody

Sign In for Pricing
View Details