Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76)

This Recombinant Human T cell receptor beta variable 7-6 (TVB76) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Mouse IgA Antibody (Cy5)
orb2987184-01 100 µL

Goat Anti-Mouse IgA Antibody (Cy5)

Sign In for Pricing
View Details
Goat Anti-Mouse IgA Antibody (Cy5)
orb2987184-02 500 µL

Goat Anti-Mouse IgA Antibody (Cy5)

Sign In for Pricing
View Details
Goat Anti-Mouse IgA Antibody (Cy5)
orb2987184-03 1 mL

Goat Anti-Mouse IgA Antibody (Cy5)

Sign In for Pricing
View Details
DMTF1 Polyclonal Conjugated Antibody
C29965 100 µL

DMTF1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Delftia acidovorans Aspartate--tRNA ligase (aspS), partial
MBS1121139 Inquire

Recombinant Delftia acidovorans Aspartate--tRNA ligase (aspS), partial

Sign In for Pricing
View Details
Human IRX1 Protein Lysate 20ug
IHUIRX1PLLY20UG 20 µg

Human IRX1 Protein Lysate 20ug

Sign In for Pricing
View Details