Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-6 (TVB76)

This Recombinant Human T cell receptor beta variable 7-6 (TVB76) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-6 TRBV7-6

UniProt

A0A1B0GX31

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVTKRGQDVALRCDPISGHVSLYWYRQALGQGPEFLTYFNYEAQQDKSGLPNDRFSAERPEGSISTLTIQRTEQRDSAMYRCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EFNA3 Protein
E30P3118 20 µg

Recombinant Human EFNA3 Protein

Sign In for Pricing
View Details
(5-Amino-1-butyl-1H-1,3-benzodiazol-2-yl) methanol
ZYB32232-01 0.5 g

(5-Amino-1-butyl-1H-1,3-benzodiazol-2-yl) methanol

Sign In for Pricing
View Details
(5-Amino-1-butyl-1H-1,3-benzodiazol-2-yl) methanol
ZYB32232-02 5 g

(5-Amino-1-butyl-1H-1,3-benzodiazol-2-yl) methanol

Sign In for Pricing
View Details
Kallikrein 1/KLK1 Rabbit Polyclonal Antibody (Fluoro594)
orb3082387 100 µg

Kallikrein 1/KLK1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Il11 Antibody
orb864122 2 mg

Il11 Antibody

Sign In for Pricing
View Details
EEPD1 Polyclonal Antibody, Cy5 Conjugated
bs-14506R-Cy5 100 µL

EEPD1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details