Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64)

This Recombinant Human T cell receptor beta variable 6-4 (TVB64) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chlorothiophene-2-carboxylic acid chloride
OR97010 1 Each

4-Chlorothiophene-2-carboxylic acid chloride

Sign In for Pricing
View Details
Human FBN2 Knockout A549 cell line
GTR15420893 1 Vial

Human FBN2 Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant Human GDAP2 Protein
E30P64413A 50 µg

Recombinant Human GDAP2 Protein

Sign In for Pricing
View Details
Crygc (NM_001082573) Mouse Tagged ORF Clone Lentiviral Particle
MR201517L3V 200 µL

Crygc (NM_001082573) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
OTOP1 Antibody Blocking Peptide
orb1510035 500 µg

OTOP1 Antibody Blocking Peptide

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae SLZ1 Protein (aa 1-298) [His]
VAng-Wyb5822-1mg 1 mg

Recombinant Saccharomyces Cerevisiae SLZ1 Protein (aa 1-298) [His]

Sign In for Pricing
View Details