Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78)

This Recombinant Human T cell receptor beta variable 7-8 (TVB78) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-Diphenyl-1H-pyrazole-4-carbaldehyde
sc-473593 1 g

1,3-Diphenyl-1H-pyrazole-4-carbaldehyde

Sign In for Pricing
View Details
Human Mannose Receptor C Type 2 (MRC2) ELISA Kit
abx572670 96 Well

Human Mannose Receptor C Type 2 (MRC2) ELISA Kit

Sign In for Pricing
View Details
SR-2B Polyclonal Antibody
ABP54802-01 30 µL

SR-2B Polyclonal Antibody

Sign In for Pricing
View Details
SR-2B Polyclonal Antibody
ABP54802-02 100 µL

SR-2B Polyclonal Antibody

Sign In for Pricing
View Details
SR-2B Polyclonal Antibody
ABP54802-03 200 µL

SR-2B Polyclonal Antibody

Sign In for Pricing
View Details
Rat Bone-specific Alkphase B, ALP-B ELISA Kit
SL0129Ra-01 48 Tests

Rat Bone-specific Alkphase B, ALP-B ELISA Kit

Sign In for Pricing
View Details