Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-8 (TVB78)

This Recombinant Human T cell receptor beta variable 7-8 (TVB78) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-8 TRBV7-8

UniProt

A0A1B0GX51

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGQDVALRCDPISGHVSLFWYQQALGQGPEFLTYFQNEAQLDKSGLPSDRFFAERPEGSVSTLKIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4760-5p antagomir
HY-RI01379A-01 5 nmol

Hsa-miR-4760-5p antagomir

Sign In for Pricing
View Details
Hsa-miR-4760-5p antagomir
HY-RI01379A-02 20 nmol

Hsa-miR-4760-5p antagomir

Sign In for Pricing
View Details
PODXL Antibody
orb3161305-01 50 µL

PODXL Antibody

Sign In for Pricing
View Details
PODXL Antibody
orb3161305-02 100 µL

PODXL Antibody

Sign In for Pricing
View Details
WT1 Rabbit mAb
E45R11537N-100 100 µL

WT1 Rabbit mAb

Sign In for Pricing
View Details
BABAM2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-5710R-BF750 100 µL

BABAM2 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details