Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1)

This Recombinant Human T cell receptor delta variable 1 (TRDV1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV16 E6 (2E3) Monoclonal Antibody, Cy5.5 Conjugated
bsm-0990M-Cy5.5 100 µL

HPV16 E6 (2E3) Monoclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
(+/-) -nerolidol
C10934 25 µL

(+/-) -nerolidol

Sign In for Pricing
View Details
FGF8 Polyclonal Antibody, PE Conjugated
bs-0735R-PE 100 µL

FGF8 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Histone, aa29-35[Ala32]
MBS659243-01 1 mg

Histone, aa29-35[Ala32]

Sign In for Pricing
View Details
Histone, aa29-35[Ala32]
MBS659243-02 5x 1 mg

Histone, aa29-35[Ala32]

Sign In for Pricing
View Details
Aquaporin 1 (AQP1) Human shRNA Plasmid Kit (Locus ID 358)
TR306628 1 Kit

Aquaporin 1 (AQP1) Human shRNA Plasmid Kit (Locus ID 358)

Sign In for Pricing
View Details