Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1)

This Recombinant Human T cell receptor delta variable 1 (TRDV1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RTEL1 (NM_032957) Human Over-expression Lysate
LS051750-100ug 100 µg

RTEL1 (NM_032957) Human Over-expression Lysate

Sign In for Pricing
View Details
Sarafloxacin HCl
C08173 50 mg

Sarafloxacin HCl

Sign In for Pricing
View Details
CIAP Antibody
orb74549 100 µL

CIAP Antibody

Sign In for Pricing
View Details
Fer3-Like (Drosophila) Peptide
abx617094 100 µg

Fer3-Like (Drosophila) Peptide

Sign In for Pricing
View Details
GlyR β (D-8) Alexa Fluor® 680
sc-365819 AF680 200 µg/mL

GlyR β (D-8) Alexa Fluor® 680

Sign In for Pricing
View Details
Anti-mouse CD11c-Invivo
C18289-5mg*20 20x 5mg

Anti-mouse CD11c-Invivo

Sign In for Pricing
View Details