Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 2 (TVB2)

This Recombinant Human T cell receptor beta variable 2 (TVB2) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 2 TRBV2

UniProt

A0A1B0GX68

Expression Region

20-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cldn11 shRNA (UAS) - Lentiviral mouse Cldn11 shRNA (UAS) (25)
GTR15178397 1 Vial

Lentiviral mouse Cldn11 shRNA (UAS) - Lentiviral mouse Cldn11 shRNA (UAS) (25)

Sign In for Pricing
View Details
PPP3R2 protein (His tag)
80R-1747 0.05 mg

PPP3R2 protein (His tag)

Sign In for Pricing
View Details
Olfr986 Lentiviral Activation Particles (m)
sc-434737-LAC 200 µL

Olfr986 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Zswim1 (NM_028028) Mouse Tagged Lenti ORF Clone
MR207265L4 10 µg

Zswim1 (NM_028028) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPUSD3 Protein Vector (Mouse) (pPM-C-HA)
PV225780 500 ng

RPUSD3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Goat anti-Gamma-aminobutyric acid receptor subunit alpha-6 antibody ELISA Kit
MBS7274304-01 48 Well

Goat anti-Gamma-aminobutyric acid receptor subunit alpha-6 antibody ELISA Kit

Sign In for Pricing
View Details