Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 2 (TVB2)

This Recombinant Human T cell receptor beta variable 2 (TVB2) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 2 TRBV2

UniProt

A0A1B0GX68

Expression Region

20-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DPYSL2 Protein Lysate
MBS8410720-01 0.02 mg

Human DPYSL2 Protein Lysate

Sign In for Pricing
View Details
Human DPYSL2 Protein Lysate
MBS8410720-02 5x 0.02 mg

Human DPYSL2 Protein Lysate

Sign In for Pricing
View Details
UQCRC2 Protein Vector (Rat) (pPM-C-HA)
49234026 500 ng

UQCRC2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
EPB41 Rabbit pAb, AP conjugated
orb2866551 100 µL

EPB41 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
EMP1 (N-term) Antibody
orb2629913 100 µL

EMP1 (N-term) Antibody

Sign In for Pricing
View Details
Mouse mmu-miR-7052-3p miRNA Antagomir
abx889410-01 10 nmol

Mouse mmu-miR-7052-3p miRNA Antagomir

Sign In for Pricing
View Details