Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 2 (TVB2)

This Recombinant Human T cell receptor beta variable 2 (TVB2) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 2 TRBV2

UniProt

A0A1B0GX68

Expression Region

20-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin 6 Antibody (PRDX6)
R31763 100 µg

Peroxiredoxin 6 Antibody (PRDX6)

Sign In for Pricing
View Details
IRF-2 shRNA Plasmid (m)
sc-35709-SH 20 µg

IRF-2 shRNA Plasmid (m)

Sign In for Pricing
View Details
Bovine Gastrin Releasing Peptide ELISA Kit
OM621588 96 Strip Well

Bovine Gastrin Releasing Peptide ELISA Kit

Sign In for Pricing
View Details
Goat Orexin A ELISA Kit
EIA06147Go 1 Kit

Goat Orexin A ELISA Kit

Sign In for Pricing
View Details
Recombinant Toxoplasma Gondii HXK Protein (aa 1-468)
VAng-0433Lsx-500gEcoli 500 µg (E. coli)

Recombinant Toxoplasma Gondii HXK Protein (aa 1-468)

Sign In for Pricing
View Details
TARDBP Protein Vector (Human) (pPB-N-His)
PV041238 500 ng

TARDBP Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details