Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5)

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP citrate lyase Recombinant Rabbit monoclonal Antibody
HA750171 100 µL

ATP citrate lyase Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
HPSE2 (NM_001166244) Human Over-expression Lysate
LC433242 20 µg

HPSE2 (NM_001166244) Human Over-expression Lysate

Sign In for Pricing
View Details
MFluor™ Violet 540 Styramide
45077-AAT 100 Slides

MFluor™ Violet 540 Styramide

Sign In for Pricing
View Details
Recombinant Human VWF F8VWF Protein (Trx Tag)
PDEH100620-01 20 µg

Recombinant Human VWF F8VWF Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human VWF F8VWF Protein (Trx Tag)
PDEH100620-02 100 µg

Recombinant Human VWF F8VWF Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human VWF F8VWF Protein (Trx Tag)
PDEH100620-03 500 µg

Recombinant Human VWF F8VWF Protein (Trx Tag)

Sign In for Pricing
View Details