Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5)

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD69 Protein Vector (Rat) (pPB-N-His)
PV258687 500 ng

CD69 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Nori® Rabbit IL-1ra ELISA Kit
GR144001 96 Well

Nori® Rabbit IL-1ra ELISA Kit

Sign In for Pricing
View Details
CRBN ligand-413
HY-W953766 1 Each

CRBN ligand-413

Sign In for Pricing
View Details
Ngrn (NM_031375) Mouse Tagged ORF Clone Lentiviral Particle
MR202776L3V 200 µL

Ngrn (NM_031375) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
IGSF5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
24782061 1.0 µg DNA

IGSF5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Human IL3RA Protein, hFc-tagged, Alexa Fluor 555 conjugated
IL3RA-121HAF555 20 μg- 50 μg- 100 μg

Recombinant Human IL3RA Protein, hFc-tagged, Alexa Fluor 555 conjugated

Sign In for Pricing
View Details