Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-4 (TVB74)

This Recombinant Human T cell receptor beta variable 7-4 (TVB74) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-4 TRBV7-4

UniProt

A0A1B0GX95

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPRYKVAKRGRDVALRCDSISGHVTLYWYRQTLGQGSEVLTYSQSDAQRDKSGRPSGRFSAERPERSVSTLKIQRTEQGDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFTR Polyclonal Antibody
E44H01848 100 µL

CFTR Polyclonal Antibody

Sign In for Pricing
View Details
Azilsartan
B2210-5.1 10 mM (in 1mL DMSO)

Azilsartan

Sign In for Pricing
View Details
BCL7C (NM_004765) Human Over-expression Lysate
LS009274-20ug 20 µg

BCL7C (NM_004765) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Monoclonal Caldesmon/CALD1 Antibody (CALD1/820) [HRP]
NBP2-47818H 0.1 mL

Mouse Monoclonal Caldesmon/CALD1 Antibody (CALD1/820) [HRP]

Sign In for Pricing
View Details
FANCA, ID (FANCA, FAA, FACA, FANCH, Fanconi anemia group A protein) (APC) discontinued
035505-APC 200 µL

FANCA, ID (FANCA, FAA, FACA, FANCH, Fanconi anemia group A protein) (APC) discontinued

Sign In for Pricing
View Details
PHD finger protein 1 (PHF1) Antibody
abx332701 100 µL

PHD finger protein 1 (PHF1) Antibody

Sign In for Pricing
View Details