Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2B type 2-K1 (H2BK1)

This Recombinant Human Histone H2B type 2-K1 (H2BK1) spans the amino acid sequence from region 2-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2B type 2-K1; Histone H2B type 2-E1; H2BK1 H2BE1

UniProt

A0A2R8Y619

Expression Region

2-122

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SAEYGQRQQPGGRGGRSSGNKKSKKRCRRKESYSMYIYKVLKQVHPDIGISAKAMSIMNSFVNDVFEQLACEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL23AP82 siRNA Oligos set (Human)
41211171 3x 5 nmol

RPL23AP82 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human mast cell tryptase,MCT ELISA KIT
JOT-EK0966Hu-01 96 Well

Human mast cell tryptase,MCT ELISA KIT

Sign In for Pricing
View Details
Human mast cell tryptase,MCT ELISA KIT
JOT-EK0966Hu-02 48 Well

Human mast cell tryptase,MCT ELISA KIT

Sign In for Pricing
View Details
IL2 Receptor beta (IL2RB) Human Over-expression Lysate
orb1379146 20 µg

IL2 Receptor beta (IL2RB) Human Over-expression Lysate

Sign In for Pricing
View Details
Frk, CT (Frk, Bsk, Iyk, Tyrosine-protein kinase FRK, Beta-cell Src-homology tyrosine kinase, FYN-related kinase, Intestine tyrosine kinase) (AP)
MBS6300125-01 0.2 mL

Frk, CT (Frk, Bsk, Iyk, Tyrosine-protein kinase FRK, Beta-cell Src-homology tyrosine kinase, FYN-related kinase, Intestine tyrosine kinase) (AP)

Sign In for Pricing
View Details
Frk, CT (Frk, Bsk, Iyk, Tyrosine-protein kinase FRK, Beta-cell Src-homology tyrosine kinase, FYN-related kinase, Intestine tyrosine kinase) (AP)
MBS6300125-02 5x 0.2 mL

Frk, CT (Frk, Bsk, Iyk, Tyrosine-protein kinase FRK, Beta-cell Src-homology tyrosine kinase, FYN-related kinase, Intestine tyrosine kinase) (AP)

Sign In for Pricing
View Details