Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A-like 3 (H2AL3)

This Recombinant Human Histone H2A-like 3 (H2AL3) spans the amino acid sequence from region 1-148. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2A-like 3; H2A.L.3; H2AL3 H2AL1RP

UniProt

A0A3B3IU63

Expression Region

1-148

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAGNKMFCRPRRQRLSHSRRAELQFPVSHLERCLRESQHARHLSSTTPVFLAGVLEYLTANILEKVGKEVKNSCRLCITPEHVKRALQKDEQLRWILELEDDTHSQVEEMPQSEEEEEEEEEKEEEMVVLVVMGGRRRRRRRRRRKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TANC2 (NM_025185) Human Over-expression Lysate
LC429752 20 µg

TANC2 (NM_025185) Human Over-expression Lysate

Sign In for Pricing
View Details
5-HT-2A Antibody
8C12013-AAT 50 µg

5-HT-2A Antibody

Sign In for Pricing
View Details
CD162 (SELPLG) Human Recombinant Protein
TP724007 100 µg

CD162 (SELPLG) Human Recombinant Protein

Sign In for Pricing
View Details
EPS8L1 (NM_133180) Human Recombinant Protein
TP313074M 100 µg

EPS8L1 (NM_133180) Human Recombinant Protein

Sign In for Pricing
View Details
TotalPure™ Metal Free Centrifuge Tubes
C2903 500 Units/Case

TotalPure™ Metal Free Centrifuge Tubes

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (PTPRC/2877R), CF640R conjugate, 0.1mg/mL
BNC402877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details