Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-1 (TVB51)

This Recombinant Human T cell receptor beta variable 5-1 (TVB51) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-1 TRBV5-1 TCRBV5S1A1T

UniProt

A0A578

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TCP1 alpha Antibody Picoband® (monoclonal, 2E7) (iFluor647 Conjugate)
M02389-iFluor647 100 µg

Anti-TCP1 alpha Antibody Picoband® (monoclonal, 2E7) (iFluor647 Conjugate)

Sign In for Pricing
View Details
50μl, filtered, automated conductive Tecan pipette tips, boxed
ZDLXT-50-T 96 pcs/box, 24 boxes/ctn

50μl, filtered, automated conductive Tecan pipette tips, boxed

Sign In for Pricing
View Details
Human hsa-miR-323b-3p miRNA Agomir
abx880964-01 5 nmol

Human hsa-miR-323b-3p miRNA Agomir

Sign In for Pricing
View Details
Human hsa-miR-323b-3p miRNA Agomir
abx880964-02 10 nmol

Human hsa-miR-323b-3p miRNA Agomir

Sign In for Pricing
View Details
Klf14 Rat Pre-designed siRNA Set A
HY-RS29117 1 Set

Klf14 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Fance 3'UTR Luciferase Stable Cell Line
TU106349 1.0 mL

Fance 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details