Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-2 (TVBK2)

This Recombinant Human T cell receptor beta variable 11-2 (TVBK2) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-2 TRBV11-2 TCRBV21S3A2N2T

UniProt

A0A584

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVAQSPRYKIIEKRQSVAFWCNPISGHATLYWYQQILGQGPKLLIQFQNNGVVDDSQLPKDRFSAERLKGVDSTLKIQPAKLEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig Carboxypeptidase B1 (CPB1) ELISA Kit
abx515587 96 Tests

Pig Carboxypeptidase B1 (CPB1) ELISA Kit

Sign In for Pricing
View Details
Smarca2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
44407116 3x 1.0 µg

Smarca2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
VSIG4 (NM_001100431) Human 3' UTR Clone
SC207251 10 µg

VSIG4 (NM_001100431) Human 3' UTR Clone

Sign In for Pricing
View Details
FGF-21, Recombinant, Human (Fibroblast Growth Factor 21, FGFL) discontinued
219755 10 µg

FGF-21, Recombinant, Human (Fibroblast Growth Factor 21, FGFL) discontinued

Sign In for Pricing
View Details
Recombinant Human ZFHX2 Protein
E30P2733 20 µg

Recombinant Human ZFHX2 Protein

Sign In for Pricing
View Details
pCMV-SPORT6.ccdb-Smn1-r Plasmid
PVT22256 2 µg

pCMV-SPORT6.ccdb-Smn1-r Plasmid

Sign In for Pricing
View Details