Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-3 (TVB43)

This Recombinant Human T cell receptor beta variable 4-3 (TVB43) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-3 TRBV4-3 TCRBV7S2A1N4T

UniProt

A0A589

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR3 Rabbit Polyclonal Antibody (HRP)
orb2612784 100 µg

TLR3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
PCDH-CMV-GRIN2AEF1A-EGFP-T2A-PURO
BZ0928-2 1 Vial

PCDH-CMV-GRIN2AEF1A-EGFP-T2A-PURO

Sign In for Pricing
View Details
Human Angiopoietin-1 receptor (TEK) ELISA kit
CSB-EL023375HU-01 48 Tests

Human Angiopoietin-1 receptor (TEK) ELISA kit

Sign In for Pricing
View Details
Human Angiopoietin-1 receptor (TEK) ELISA kit
CSB-EL023375HU-02 96 Tests

Human Angiopoietin-1 receptor (TEK) ELISA kit

Sign In for Pricing
View Details
Human Angiopoietin-1 receptor (TEK) ELISA kit
CSB-EL023375HU-03 5x 96 Tests

Human Angiopoietin-1 receptor (TEK) ELISA kit

Sign In for Pricing
View Details
Human Angiopoietin-1 receptor (TEK) ELISA kit
CSB-EL023375HU-04 10x 96 Tests

Human Angiopoietin-1 receptor (TEK) ELISA kit

Sign In for Pricing
View Details