Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-3 (TVB43)

This Recombinant Human T cell receptor beta variable 4-3 (TVB43) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-3 TRBV4-3 TCRBV7S2A1N4T

UniProt

A0A589

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V0E2 Antibody
GWB-MS378I 50 µg

ATP6V0E2 Antibody

Sign In for Pricing
View Details
Human CIROP Pre-designed siRNA Set B
SI003112B 1 Each

Human CIROP Pre-designed siRNA Set B

Sign In for Pricing
View Details
PHD2/EGLN1 ReadyGo IHC Kit
SIHCZ-0248-01 50 Tests (No Control Slide)

PHD2/EGLN1 ReadyGo IHC Kit

Sign In for Pricing
View Details
PHD2/EGLN1 ReadyGo IHC Kit
SIHCZ-0248-02 50 Tests (With Control Slide)

PHD2/EGLN1 ReadyGo IHC Kit

Sign In for Pricing
View Details
Fibrillin 1 (MaxLight 750) discontinued
F4195-02-ML750 100 µL

Fibrillin 1 (MaxLight 750) discontinued

Sign In for Pricing
View Details
HNRNPA1P5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV728403 1.0 µg DNA

HNRNPA1P5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details