Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-3 (TVB43)

This Recombinant Human T cell receptor beta variable 4-3 (TVB43) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-3 TRBV4-3 TCRBV7S2A1N4T

UniProt

A0A589

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Granzyme A (CB9) PE
sc-56115 PE 200 µg/mL

Granzyme A (CB9) PE

Sign In for Pricing
View Details
Polyclonal CIRBP (aa 81-91) Antibody (internal region)
APG00688G 0.1mg

Polyclonal CIRBP (aa 81-91) Antibody (internal region)

Sign In for Pricing
View Details
TOPAZ1 siRNA (Mouse)
CRN5291-01 15 nmol

TOPAZ1 siRNA (Mouse)

Sign In for Pricing
View Details
TOPAZ1 siRNA (Mouse)
CRN5291-02 30 nmol

TOPAZ1 siRNA (Mouse)

Sign In for Pricing
View Details
Anti-ADAMTS1 Antibody Picoband® Fluoro550 Conjugated
PA2071-Fluoro550 100 µg/Vial

Anti-ADAMTS1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Rabbit anti-TRAP100 Antibody
MBS4512748-01 0.05 mL

Rabbit anti-TRAP100 Antibody

Sign In for Pricing
View Details