Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 45 (SMI45), partial

This Recombinant Human Small integral membrane protein 45 (SMI45), partial spans the amino acid sequence from region 28-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 45 SMIM45 LINC00634

UniProt

A0A590UK83

Expression Region

28-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYFEPGLQEAHKWRMQRPLVDRDLRKTLMVRDNLAFGGPEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Live-or-DyeTM 787/808 Fixable Viability Staining Kit, Trial Size (50 assays)
#32011-T 1 Kit

Live-or-DyeTM 787/808 Fixable Viability Staining Kit, Trial Size (50 assays)

Sign In for Pricing
View Details
CCDC15 Human Gene Knockout Kit (CRISPR)
KN423891 1 Kit

CCDC15 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G10]
TA503415AM 100 µL

Cytochrome P450 17A1 (CYP17A1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G10]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human IL-4 Antibody[MP4-25D2]
E-AB-F12030-01 100 µg

AF/LE Purified Anti-Human IL-4 Antibody[MP4-25D2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human IL-4 Antibody[MP4-25D2]
E-AB-F12030-02 1 mg

AF/LE Purified Anti-Human IL-4 Antibody[MP4-25D2]

Sign In for Pricing
View Details
AF/LE Purified Anti-Human IL-4 Antibody[MP4-25D2]
E-AB-F12030-03 5 mg

AF/LE Purified Anti-Human IL-4 Antibody[MP4-25D2]

Sign In for Pricing
View Details