Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 45 (SMI45), partial

This Recombinant Human Small integral membrane protein 45 (SMI45), partial spans the amino acid sequence from region 28-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 45 SMIM45 LINC00634

UniProt

A0A590UK83

Expression Region

28-68

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YYFEPGLQEAHKWRMQRPLVDRDLRKTLMVRDNLAFGGPEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CLEC18C activation kit by CRISPRa
GA117075 1 Kit

Human CLEC18C activation kit by CRISPRa

Sign In for Pricing
View Details
CD44v3 (Marker of Tumor Metastasis) (3G5), CF488A conjugate, 0.1mg/mL
BNC882429-100 1x 100 µL

CD44v3 (Marker of Tumor Metastasis) (3G5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Androsta-1,4,6-triene-3,17-dione
TRC-A637530-25MG 25 mg

Androsta-1,4,6-triene-3,17-dione

Sign In for Pricing
View Details
10X Buffer V1, 5 x 1ml
RB0208 5x 1 mL

10X Buffer V1, 5 x 1ml

Sign In for Pricing
View Details
(KO Validated) STAT3 Polyclonal Antibody
E-AB-62227-01 60 µL

(KO Validated) STAT3 Polyclonal Antibody

Sign In for Pricing
View Details
(KO Validated) STAT3 Polyclonal Antibody
E-AB-62227-02 120 µL

(KO Validated) STAT3 Polyclonal Antibody

Sign In for Pricing
View Details