Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-5 (TVB55)

This Recombinant Human T cell receptor beta variable 5-5 (TVB55) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-5 TRBV5-5 TCRBV5S3A2T

UniProt

A0A597

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdc (NM_001159730) Mouse Tagged Lenti ORF Clone
MR203046L3 10 µg

Pdc (NM_001159730) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Chicken thymus-leukemia antigen (Tla) ELISA Kit
MBS263759-01 48 Well

Chicken thymus-leukemia antigen (Tla) ELISA Kit

Sign In for Pricing
View Details
Chicken thymus-leukemia antigen (Tla) ELISA Kit
MBS263759-02 96 Well

Chicken thymus-leukemia antigen (Tla) ELISA Kit

Sign In for Pricing
View Details
Chicken thymus-leukemia antigen (Tla) ELISA Kit
MBS263759-03 5x 96 Well

Chicken thymus-leukemia antigen (Tla) ELISA Kit

Sign In for Pricing
View Details
Chicken thymus-leukemia antigen (Tla) ELISA Kit
MBS263759-04 10x 96 Well

Chicken thymus-leukemia antigen (Tla) ELISA Kit

Sign In for Pricing
View Details
Histone Acetyltransferase KAT8 (KAT8) Antibody (HRP)
abx316151-01 20 µg

Histone Acetyltransferase KAT8 (KAT8) Antibody (HRP)

Sign In for Pricing
View Details