Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-6 (TVB56)

This Recombinant Human T cell receptor beta variable 5-6 (TVB56) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-6 TRBV5-6 TCRBV5S2

UniProt

A0A599

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]
TA803611BM 100 µL

BMP4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
Tspan 13 (TSPAN13) (NM_014399) Human Recombinant Protein
TP307535 20 µg

Tspan 13 (TSPAN13) (NM_014399) Human Recombinant Protein

Sign In for Pricing
View Details
PE Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028D-01 50 Tests

PE Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
PE Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028D-02 100 Tests

PE Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
PE Anti-Mouse CD40 Antibody[FGK4.5/FGK45]
E-AB-F1028D-03 2x 100 Tests

PE Anti-Mouse CD40 Antibody[FGK4.5/FGK45]

Sign In for Pricing
View Details
Claudin 7 (CLDN7) (NM_001307) Human Over-expression Lysate
LY420015 100 µg

Claudin 7 (CLDN7) (NM_001307) Human Over-expression Lysate

Sign In for Pricing
View Details