Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-6 (TVB56)

This Recombinant Human T cell receptor beta variable 5-6 (TVB56) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-6 TRBV5-6 TCRBV5S2

UniProt

A0A599

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPKSGHDTVSWYQQALGQGPQFIFQYYEEEERQRGNFPDRFSGHQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin Recombinant Rabbit monoclonal Antibody
IRS144RB 50 Tests

Fibronectin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
rac Norphenylephrine Hydrochloride (Phenylephrine Impurity A)
TRC-N825500-10MG 10 mg

rac Norphenylephrine Hydrochloride (Phenylephrine Impurity A)

Sign In for Pricing
View Details
Anti-PRK ribulose-5-P-kinase | Phosphoribulokinase, DyLight® 488 conjugated (40 µg)
AS07 257-DL488 40 µg

Anti-PRK ribulose-5-P-kinase | Phosphoribulokinase, DyLight® 488 conjugated (40 µg)

Sign In for Pricing
View Details
Human C20orf132 (MROH8) activation kit by CRISPRa
GA115392 1 Kit

Human C20orf132 (MROH8) activation kit by CRISPRa

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD272 Antibody[6F7]
AN00415J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse CD272 Antibody[6F7]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD272 Antibody[6F7]
AN00415J-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse CD272 Antibody[6F7]

Sign In for Pricing
View Details