Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-3 (TVBK3)

This Recombinant Human T cell receptor beta variable 11-3 (TVBK3) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-3 TRBV11-3 TCRBV21S2A2

UniProt

A0A5A6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYLQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ICG Alkyne
POK1616_1 mg 1 mg

ICG Alkyne

Sign In for Pricing
View Details
Anti-DMPK Antibody Picoband® Fluoro550 Conjugated
A00797-2-Fluoro550 100 µg/Vial

Anti-DMPK Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
IGHVII-67-1 sgRNA CRISPR Lentivector set (Human)
K1047101 3x 1.0 µg

IGHVII-67-1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MAT1/2A Blocking Peptide - (Dry Ice)
NB110-94162PEP 0.05 mg

MAT1/2A Blocking Peptide - (Dry Ice)

Sign In for Pricing
View Details
Simport Embedding Cassette Pink
HIS0088 10 / PCK

Simport Embedding Cassette Pink

Sign In for Pricing
View Details
ORMDL2 shRNA (h) Lentiviral Particles
sc-96102-V 200 µL

ORMDL2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details