Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 11-3 (TVBK3)

This Recombinant Human T cell receptor beta variable 11-3 (TVBK3) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 11-3 TRBV11-3 TCRBV21S2A2

UniProt

A0A5A6

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVVQSPRYKIIEKKQPVAFWCNPISGHNTLYWYLQNLGQGPELLIRYENEEAVDDSQLPKDRFSAERLKGVDSTLKIQPAELGDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fcf1-set siRNA/shRNA/RNAi Lentivector (Mouse)
20379094 4x 500 ng

Fcf1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Fibroblast Growth Factor 18 (FGF18) BioAssayTM ELISA Kit (Human)
025048 96 Tests

Fibroblast Growth Factor 18 (FGF18) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Mouse NKA (Neurokinin A) ELISA Kit
MBS8803876-01 48 Well

Mouse NKA (Neurokinin A) ELISA Kit

Sign In for Pricing
View Details
Mouse NKA (Neurokinin A) ELISA Kit
MBS8803876-02 96 Well

Mouse NKA (Neurokinin A) ELISA Kit

Sign In for Pricing
View Details
Mouse NKA (Neurokinin A) ELISA Kit
MBS8803876-03 5x 96 Well

Mouse NKA (Neurokinin A) ELISA Kit

Sign In for Pricing
View Details
Mouse NKA (Neurokinin A) ELISA Kit
MBS8803876-04 10x 96 Well

Mouse NKA (Neurokinin A) ELISA Kit

Sign In for Pricing
View Details