Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 14 (TVB14)

This Recombinant Human T cell receptor beta variable 14 (TVB14) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 14 TRBV14 TCRBV14S1 TCRBV16S1A1N1

UniProt

A0A5B0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK4 (NM_001014831) Human Recombinant Protein
TP306847L 1 mg

PAK4 (NM_001014831) Human Recombinant Protein

Sign In for Pricing
View Details
Bis(2-aminoethyl)(nitroso)amine Dihydrochloride
TRC-E741655-10MG 10 mg

Bis(2-aminoethyl)(nitroso)amine Dihydrochloride

Sign In for Pricing
View Details
N-Benzyloxycarbonylhydroxylamine
TRC-B285915-5G 5 g

N-Benzyloxycarbonylhydroxylamine

Sign In for Pricing
View Details
Human CD30 (Cluster of Differentiation 30) ELISA Kit
E-EL-H6215-01 24 Tests

Human CD30 (Cluster of Differentiation 30) ELISA Kit

Sign In for Pricing
View Details
Human CD30 (Cluster of Differentiation 30) ELISA Kit
E-EL-H6215-02 48 Tests

Human CD30 (Cluster of Differentiation 30) ELISA Kit

Sign In for Pricing
View Details
Human CD30 (Cluster of Differentiation 30) ELISA Kit
E-EL-H6215-03 96 Tests

Human CD30 (Cluster of Differentiation 30) ELISA Kit

Sign In for Pricing
View Details