Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 28 (TVB28)

This Recombinant Human T cell receptor beta variable 28 (TVB28) spans the amino acid sequence from region 27-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 28 TRBV28 TCRBV3S1

UniProt

A0A5B6

Expression Region

27-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pOTB7-RPA2 Plasmid
PVT24102 2 µg

pOTB7-RPA2 Plasmid

Sign In for Pricing
View Details
Stfa3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV685217 1.0 µg DNA

Stfa3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ADRB2 (S261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (Azide free) (HRP)
MBS6461790-01 0.2 mL

ADRB2 (S261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (Azide free) (HRP)

Sign In for Pricing
View Details
ADRB2 (S261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (Azide free) (HRP)
MBS6461790-02 5x 0.2 mL

ADRB2 (S261) (ADRB2R, ADRBR, B2AR, BAR, Beta-2 Adrenergic Receptor, Beta-2 Adrenoceptor, Beta-2 Adrenoreceptor, BETA2AR, Adrenergic, beta-2-, Receptor, Surface) (Azide free) (HRP)

Sign In for Pricing
View Details
Anti-Nucleolin Rabbit Monoclonal Antibody, Carrier-free
M00228-3-carrier-free 100 µL

Anti-Nucleolin Rabbit Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
ASCL2 (NM_005170) Human Recombinant Protein
PROTQ99929 20 µg

ASCL2 (NM_005170) Human Recombinant Protein

Sign In for Pricing
View Details