Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29)

This Recombinant Human T cell receptor beta variable 29-1 (TVB29) spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QRSL1, NT (QRSL1, Glutamyl-tRNA (Gln) amidotransferase subunit A, mitochondrial, Glutaminyl-tRNA synthase-like protein 1) (MaxLight 490) discontinued
040724-ML490 100 µL

QRSL1, NT (QRSL1, Glutamyl-tRNA (Gln) amidotransferase subunit A, mitochondrial, Glutaminyl-tRNA synthase-like protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Beta-Melanocyte Stimulating Hormone (βMSH) Mouse ELISA Kit
B9044 96 Tests

Beta-Melanocyte Stimulating Hormone (βMSH) Mouse ELISA Kit

Sign In for Pricing
View Details
Pla2g6 Mouse shRNA Lentiviral Particle (Locus ID 53357)
TL515018V 500 µL Each

Pla2g6 Mouse shRNA Lentiviral Particle (Locus ID 53357)

Sign In for Pricing
View Details
Lentiviral mouse Fam219b shRNA (UAS) - Lentiviral mouse Fam219b shRNA (UAS, iRFP) (100)
GTR15207435 1 Vial

Lentiviral mouse Fam219b shRNA (UAS) - Lentiviral mouse Fam219b shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
RGD1305014 AAV siRNA Pooled Vector
38924166 1.0 µg

RGD1305014 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CLP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV664509 1.0 µg DNA

CLP1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details