Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382)

This Recombinant Human T cell receptor alpha variable 38-2/delta variable 8 (TV382) spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 38-2/delta variable 8 TRAV38-2DV8

UniProt

A0JD32

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVTQSQPEMSVQEAETVTLSCTYDTSESDYYLFWYKQPPSRQMILVIRQEAYKQQNATENRFSVNFQKAAKSFSLKISDSQLGDAAMYFCAYRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDND2 AAV Vector (Human) (CMV)
16291101 1 µg

CLDND2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human IL-11 Biotinylated Affinity Purified PAb
BAF218 50 µg

Human IL-11 Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
Scap ORF Vector (Mouse) (pORF)
43093014 1.0 µg DNA

Scap ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Bovine Nitrilase homolog 1, NIT1 ELISA KIT
ELI-13655b 96 Tests

Bovine Nitrilase homolog 1, NIT1 ELISA KIT

Sign In for Pricing
View Details
Bovine Caspase-8 subunit p10 ELISA kit
GTR10412739 96 Well

Bovine Caspase-8 subunit p10 ELISA kit

Sign In for Pricing
View Details
Ferritin discontinued
214828 1 mg

Ferritin discontinued

Sign In for Pricing
View Details