Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3)

This Recombinant Human T cell receptor delta variable 3 (TRDV3) spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LDLRAD3
322229-01 50 µg

LDLRAD3

Sign In for Pricing
View Details
LDLRAD3
322229-02 100 µg

LDLRAD3

Sign In for Pricing
View Details
SES1 Antibody (FITC)
orb28273-01 50 µg

SES1 Antibody (FITC)

Sign In for Pricing
View Details
SES1 Antibody (FITC)
orb28273-02 100 µg

SES1 Antibody (FITC)

Sign In for Pricing
View Details
HDAC7 Antibody [P6D17]
C21848-20uL 20 µL

HDAC7 Antibody [P6D17]

Sign In for Pricing
View Details
SB 258585
465902-01 10 mg

SB 258585

Sign In for Pricing
View Details