Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3)

This Recombinant Human T cell receptor delta variable 3 (TRDV3) spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Alanine Aminopeptidase (AAP) CLIA Kit
abx492377-01 96 Tests

Rat Alanine Aminopeptidase (AAP) CLIA Kit

Sign In for Pricing
View Details
Rat Alanine Aminopeptidase (AAP) CLIA Kit
abx492377-02 5x 96 Tests

Rat Alanine Aminopeptidase (AAP) CLIA Kit

Sign In for Pricing
View Details
Rat Alanine Aminopeptidase (AAP) CLIA Kit
abx492377-03 10x 96 Tests

Rat Alanine Aminopeptidase (AAP) CLIA Kit

Sign In for Pricing
View Details
Cartridge, 1" thick, for 84 Eppendorf tubes 10mm diameter, for Multi-Pulse Vortexer
099A VC10841 1 Each

Cartridge, 1" thick, for 84 Eppendorf tubes 10mm diameter, for Multi-Pulse Vortexer

Sign In for Pricing
View Details
HSD11B1 Polyclonal Antibody
MBS2562094-01 0.02 mL

HSD11B1 Polyclonal Antibody

Sign In for Pricing
View Details
HSD11B1 Polyclonal Antibody
MBS2562094-02 0.06 mL

HSD11B1 Polyclonal Antibody

Sign In for Pricing
View Details