Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 3 subunit C-like protein (EIFCL), partial

This Recombinant Human Eukaryotic translation initiation factor 3 subunit C-like protein (EIFCL), partial spans the amino acid sequence from region 674-850. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 3 subunit C-like protein EIF3CL

UniProt

B5ME19

Expression Region

674-850

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Kvbeta1.2 K+ Channel Antibody
75-019 100 µL

Anti-Kvbeta1.2 K+ Channel Antibody

Sign In for Pricing
View Details
Mouse RANK EZ-Set™ ELISA Kit (DIY Antibody Pairs)
EZ0830 5 Plates/Kit

Mouse RANK EZ-Set™ ELISA Kit (DIY Antibody Pairs)

Sign In for Pricing
View Details
ZNF629 Recombinant Protein (Human)
RP108953 100 µg

ZNF629 Recombinant Protein (Human)

Sign In for Pricing
View Details
SPATA17 Polyclonal Antibody
MBS2526616-01 0.02 mL

SPATA17 Polyclonal Antibody

Sign In for Pricing
View Details
SPATA17 Polyclonal Antibody
MBS2526616-02 0.06 mL

SPATA17 Polyclonal Antibody

Sign In for Pricing
View Details
SPATA17 Polyclonal Antibody
MBS2526616-03 0.12 mL

SPATA17 Polyclonal Antibody

Sign In for Pricing
View Details