Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Eukaryotic translation initiation factor 3 subunit C-like protein (EIFCL), partial

This Recombinant Human Eukaryotic translation initiation factor 3 subunit C-like protein (EIFCL), partial spans the amino acid sequence from region 674-850. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Eukaryotic translation initiation factor 3 subunit C-like protein EIF3CL

UniProt

B5ME19

Expression Region

674-850

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FHLHINLELLECVYLVSAMLLEIPYMAAHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLFPEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPTQTVVMHRTEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Agar
C03119-01 50 mg

Agar

Sign In for Pricing
View Details
Agar
C03119-02 250 mg

Agar

Sign In for Pricing
View Details
Mmu-miR-872-5p miRNA Agomir
orb1918431-01 5 nmol

Mmu-miR-872-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-872-5p miRNA Agomir
orb1918431-02 10 nmol

Mmu-miR-872-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-872-5p miRNA Agomir
orb1918431-03 20 nmol

Mmu-miR-872-5p miRNA Agomir

Sign In for Pricing
View Details
ERMIN, ID (ERMN, KIAA1189, Ermin, Juxtanodin) (FITC) discontinued
035213-FITC 200 µL

ERMIN, ID (ERMN, KIAA1189, Ermin, Juxtanodin) (FITC) discontinued

Sign In for Pricing
View Details