Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HOXB-AS3 peptide (HAS3P)

This Recombinant Human HOXB-AS3 peptide (HAS3P) spans the amino acid sequence from region 1-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HOXB-AS3 peptide HOXB-AS3

UniProt

C0HLZ6

Expression Region

1-53

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Timapiprant (OC 000459) 200mg
A11946-200 200 mg

Timapiprant (OC 000459) 200mg

Sign In for Pricing
View Details
SUPT4H1 CRISPRa sgRNA lentivector (set of three targets)(Human)
45893121 3x 1.0µg DNA

SUPT4H1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ERG Recombinant Protein
OPCA02653-20UG 20 µg

ERG Recombinant Protein

Sign In for Pricing
View Details
MARCO (NM_006770) Human Tagged ORF Clone Lentiviral Particle
RC205625L4V 200 µL

MARCO (NM_006770) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2,3-Dioxoindoline-4-carboxylic acid
OR1102109-01 100 mg

2,3-Dioxoindoline-4-carboxylic acid

Sign In for Pricing
View Details
2,3-Dioxoindoline-4-carboxylic acid
OR1102109-02 250 mg

2,3-Dioxoindoline-4-carboxylic acid

Sign In for Pricing
View Details