Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HOXB-AS3 peptide (HAS3P)

This Recombinant Human HOXB-AS3 peptide (HAS3P) spans the amino acid sequence from region 1-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HOXB-AS3 peptide HOXB-AS3

UniProt

C0HLZ6

Expression Region

1-53

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVLPGTQRYPHQRRRFQAAGGGAESGKRGSEEAPGVAWSGSESGRDAATPAW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCAP Recombinant Protein (Human)
OPCA04895-100UG 100 µg

TCAP Recombinant Protein (Human)

Sign In for Pricing
View Details
Lentiviral human AMACR sgRNA gene knockout kit - Lentiviral human AMACR sgRNA gene knockout kit (plasmid)
GTR15381098 1 Vial

Lentiviral human AMACR sgRNA gene knockout kit - Lentiviral human AMACR sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Rabbit Anti-PURB Polyclonal Antibody
PAV3221 100 μL

Rabbit Anti-PURB Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal RNA Polymerase II/POLR2A Antibody (CTD 4H8) [Alexa Fluor 700]
NBP2-50274AF700 0.1 mL

Mouse Monoclonal RNA Polymerase II/POLR2A Antibody (CTD 4H8) [Alexa Fluor 700]

Sign In for Pricing
View Details
ANAPC11 3'UTR Lenti-reporter-Luc Vector
11875081 1.0 µg

ANAPC11 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Human Serum AB male only - Converted - USA - cGMP Grade - xeno-free - Heat Inactivated
S-115A-HI-US 500 mL

Human Serum AB male only - Converted - USA - cGMP Grade - xeno-free - Heat Inactivated

Sign In for Pricing
View Details