Recombinant Human Putative RNA-binding regulatory peptide (RBRP)
This Recombinant Human Putative RNA-binding regulatory peptide (RBRP) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Putative RNA-binding regulatory peptide; RBRP; Septin 14 pseudogene 20; SEPTIN14P20 C20orf69 LINC00266-1
UniProt
C0HM01
Expression Region
1-71
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1171373-01 0.02 mg (E-Coli)
Recombinant Streptococcus pneumoniae D-alanine--poly (phosphoribitol) ligase subunit 2
Sign In for Pricing
View Details